Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3515363..3515983 | Replicon | chromosome |
Accession | NZ_CP100710 | ||
Organism | Salmonella enterica subsp. enterica serovar Blockley strain R18.0186 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL733_RS17385 | Protein ID | WP_001280991.1 |
Coordinates | 3515765..3515983 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL733_RS17380 | Protein ID | WP_000344807.1 |
Coordinates | 3515363..3515737 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL733_RS17370 (3510502) | 3510502..3511695 | + | 1194 | WP_001039200.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL733_RS17375 (3511718) | 3511718..3514867 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL733_RS17380 (3515363) | 3515363..3515737 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL733_RS17385 (3515765) | 3515765..3515983 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL733_RS17390 (3516161) | 3516161..3516712 | + | 552 | WP_064047028.1 | maltose O-acetyltransferase | - |
NL733_RS17395 (3516829) | 3516829..3517299 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NL733_RS17400 (3517355) | 3517355..3517495 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL733_RS17405 (3517501) | 3517501..3517761 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NL733_RS17410 (3517986) | 3517986..3519536 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NL733_RS17420 (3519767) | 3519767..3520156 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NL733_RS17425 (3520211) | 3520211..3520780 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251164 WP_001280991.1 NZ_CP100710:3515765-3515983 [Salmonella enterica subsp. enterica serovar Blockley]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251164 WP_000344807.1 NZ_CP100710:3515363-3515737 [Salmonella enterica subsp. enterica serovar Blockley]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|