Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbDE/ParE-YafN
Location 2378222..2378744 Replicon chromosome
Accession NZ_CP100710
Organism Salmonella enterica subsp. enterica serovar Blockley strain R18.0186

Toxin (Protein)


Gene name stbE Uniprot ID V7IL40
Locus tag NL733_RS11495 Protein ID WP_000221345.1
Coordinates 2378460..2378744 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name stbD Uniprot ID V1H457
Locus tag NL733_RS11490 Protein ID WP_000885424.1
Coordinates 2378222..2378470 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL733_RS11460 (2373759) 2373759..2374766 - 1008 WP_000201082.1 LacI family DNA-binding transcriptional regulator -
NL733_RS11465 (2375024) 2375024..2375206 + 183 Protein_2243 hypothetical protein -
NL733_RS11470 (2375554) 2375554..2376289 + 736 Protein_2244 helix-turn-helix domain-containing protein -
NL733_RS11475 (2376345) 2376345..2377253 - 909 WP_077946216.1 hypothetical protein -
NL733_RS11480 (2377533) 2377533..2377865 - 333 WP_000253154.1 DUF1493 family protein -
NL733_RS11485 (2377855) 2377855..2378070 - 216 WP_000206207.1 hypothetical protein -
NL733_RS11490 (2378222) 2378222..2378470 + 249 WP_000885424.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL733_RS11495 (2378460) 2378460..2378744 + 285 WP_000221345.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NL733_RS11500 (2378915) 2378915..2379304 + 390 WP_012218813.1 RidA family protein -
NL733_RS11505 (2379356) 2379356..2380435 - 1080 WP_000954688.1 S-adenosylmethionine:tRNA ribosyltransferase-isomerase -
NL733_RS11510 (2380628) 2380628..2381116 - 489 WP_001293638.1 MarR family winged helix-turn-helix transcriptional regulator -
NL733_RS11515 (2381161) 2381161..2382669 + 1509 WP_000199415.1 FAD-dependent oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2375027..2385526 10499
- flank IS/Tn - - 2375554..2376123 569


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11043.79 Da        Isoelectric Point: 10.6500

>T251163 WP_000221345.1 NZ_CP100710:2378460-2378744 [Salmonella enterica subsp. enterica serovar Blockley]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9090.32 Da        Isoelectric Point: 3.9820

>AT251163 WP_000885424.1 NZ_CP100710:2378222-2378470 [Salmonella enterica subsp. enterica serovar Blockley]
MAFQILTTTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDEELGRIIDERANERVIEVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y2FFA8

Antitoxin

Source ID Structure
AlphaFold DB A0A5I0WPN5

References