Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2378222..2378744 | Replicon | chromosome |
Accession | NZ_CP100710 | ||
Organism | Salmonella enterica subsp. enterica serovar Blockley strain R18.0186 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | NL733_RS11495 | Protein ID | WP_000221345.1 |
Coordinates | 2378460..2378744 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NL733_RS11490 | Protein ID | WP_000885424.1 |
Coordinates | 2378222..2378470 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL733_RS11460 (2373759) | 2373759..2374766 | - | 1008 | WP_000201082.1 | LacI family DNA-binding transcriptional regulator | - |
NL733_RS11465 (2375024) | 2375024..2375206 | + | 183 | Protein_2243 | hypothetical protein | - |
NL733_RS11470 (2375554) | 2375554..2376289 | + | 736 | Protein_2244 | helix-turn-helix domain-containing protein | - |
NL733_RS11475 (2376345) | 2376345..2377253 | - | 909 | WP_077946216.1 | hypothetical protein | - |
NL733_RS11480 (2377533) | 2377533..2377865 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NL733_RS11485 (2377855) | 2377855..2378070 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NL733_RS11490 (2378222) | 2378222..2378470 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL733_RS11495 (2378460) | 2378460..2378744 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL733_RS11500 (2378915) | 2378915..2379304 | + | 390 | WP_012218813.1 | RidA family protein | - |
NL733_RS11505 (2379356) | 2379356..2380435 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NL733_RS11510 (2380628) | 2380628..2381116 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NL733_RS11515 (2381161) | 2381161..2382669 | + | 1509 | WP_000199415.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2375027..2385526 | 10499 | |
- | flank | IS/Tn | - | - | 2375554..2376123 | 569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T251163 WP_000221345.1 NZ_CP100710:2378460-2378744 [Salmonella enterica subsp. enterica serovar Blockley]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |