Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 887183..887808 | Replicon | chromosome |
Accession | NZ_CP100710 | ||
Organism | Salmonella enterica subsp. enterica serovar Blockley strain R18.0186 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A5I5T1K0 |
Locus tag | NL733_RS04330 | Protein ID | WP_001748684.1 |
Coordinates | 887410..887808 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | NL733_RS04325 | Protein ID | WP_000557545.1 |
Coordinates | 887183..887410 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL733_RS04295 (882196) | 882196..883713 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
NL733_RS04300 (883789) | 883789..884334 | - | 546 | WP_000134001.1 | isopentenyl-diphosphate Delta-isomerase | - |
NL733_RS04305 (884599) | 884599..885357 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
NL733_RS04315 (885642) | 885642..886448 | - | 807 | WP_079949449.1 | DUF1460 domain-containing protein | - |
NL733_RS04320 (886723) | 886723..886974 | - | 252 | WP_001748683.1 | hypothetical protein | - |
NL733_RS04325 (887183) | 887183..887410 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NL733_RS04330 (887410) | 887410..887808 | + | 399 | WP_001748684.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NL733_RS04335 (888614) | 888614..889150 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
NL733_RS04340 (889197) | 889197..889829 | + | 633 | WP_000835265.1 | YfdX family protein | - |
NL733_RS04345 (890548) | 890548..891135 | + | 588 | WP_001244643.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 885642..895595 | 9953 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14995.39 Da Isoelectric Point: 7.7780
>T251157 WP_001748684.1 NZ_CP100710:887410-887808 [Salmonella enterica subsp. enterica serovar Blockley]
MLKFMLDTNTCIFTIKNKPEHVKERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHVKERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T1K0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9MGW6 |