Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 876264..876924 | Replicon | chromosome |
Accession | NZ_CP100710 | ||
Organism | Salmonella enterica subsp. enterica serovar Blockley strain R18.0186 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | NL733_RS04265 | Protein ID | WP_000244756.1 |
Coordinates | 876511..876924 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | NL733_RS04260 | Protein ID | WP_000351186.1 |
Coordinates | 876264..876530 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL733_RS04240 (872192) | 872192..873625 | - | 1434 | WP_064047315.1 | 6-phospho-beta-glucosidase BglA | - |
NL733_RS04245 (873784) | 873784..874095 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
NL733_RS04250 (874259) | 874259..874918 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
NL733_RS04255 (875034) | 875034..876014 | - | 981 | WP_000874175.1 | tRNA-modifying protein YgfZ | - |
NL733_RS04260 (876264) | 876264..876530 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
NL733_RS04265 (876511) | 876511..876924 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
NL733_RS04270 (876977) | 876977..877498 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
NL733_RS04275 (877611) | 877611..878507 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
NL733_RS04280 (878531) | 878531..879244 | + | 714 | WP_064047314.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NL733_RS04285 (879250) | 879250..880983 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T251156 WP_000244756.1 NZ_CP100710:876511-876924 [Salmonella enterica subsp. enterica serovar Blockley]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT251156 WP_000351186.1 NZ_CP100710:876264-876530 [Salmonella enterica subsp. enterica serovar Blockley]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |