Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 349953..350554 | Replicon | chromosome |
Accession | NZ_CP100710 | ||
Organism | Salmonella enterica subsp. enterica serovar Blockley strain R18.0186 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A5U0JPI4 |
Locus tag | NL733_RS01635 | Protein ID | WP_024166788.1 |
Coordinates | 349953..350333 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A5T4YUW9 |
Locus tag | NL733_RS01640 | Protein ID | WP_033545779.1 |
Coordinates | 350333..350554 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL733_RS01615 (345306) | 345306..346505 | + | 1200 | WP_000804064.1 | tetracycline efflux MFS transporter Tet(A) | - |
NL733_RS01620 (346537) | 346537..347421 | - | 885 | WP_000058717.1 | EamA family transporter | - |
NL733_RS01625 (347559) | 347559..347951 | - | 393 | WP_079949553.1 | isochorismatase family cysteine hydrolase | - |
NL733_RS01630 (347955) | 347955..349706 | + | 1752 | Protein_322 | Tn3-like element TnAs1 family transposase | - |
NL733_RS01635 (349953) | 349953..350333 | - | 381 | WP_024166788.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NL733_RS01640 (350333) | 350333..350554 | - | 222 | WP_033545779.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NL733_RS01645 (350627) | 350627..351019 | - | 393 | WP_000506718.1 | S24 family peptidase | - |
NL733_RS01650 (351131) | 351131..351379 | - | 249 | WP_001286530.1 | DNA polymerase III subunit theta | - |
NL733_RS01655 (351382) | 351382..351582 | - | 201 | WP_001408980.1 | hypothetical protein | - |
NL733_RS01660 (351717) | 351717..352007 | - | 291 | WP_048659782.1 | hypothetical protein | - |
NL733_RS01665 (352135) | 352135..352839 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
NL733_RS01670 (352892) | 352892..353230 | + | 339 | Protein_330 | Tn3 family transposase | - |
NL733_RS01675 (353267) | 353267..354175 | + | 909 | WP_000174819.1 | C45 family peptidase | - |
NL733_RS01680 (354329) | 354329..355144 | - | 816 | WP_000018321.1 | aminoglycoside O-phosphotransferase APH(3')-Ia | - |
NL733_RS01685 (355281) | 355281..355394 | + | 114 | Protein_333 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | aph(3')-Ia / aph(6)-Id / aph(3'')-Ib | - | 346537..360802 | 14265 | |
- | inside | IScluster/Tn | mph(A) / tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib | - | 338729..360802 | 22073 | |
- | inside | Prophage | mph(A) / tet(A) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib | - | 300515..360802 | 60287 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13663.58 Da Isoelectric Point: 5.6406
>T251154 WP_024166788.1 NZ_CP100710:c350333-349953 [Salmonella enterica subsp. enterica serovar Blockley]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELFGSNI
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELFGSNI
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5U0JPI4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5T4YUW9 |