Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 182850..183372 Replicon plasmid pR18.0409_279k
Accession NZ_CP100708
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0409

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag NL735_RS25330 Protein ID WP_000220561.1
Coordinates 183091..183372 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NL735_RS25325 Protein ID WP_000121743.1
Coordinates 182850..183101 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL735_RS25300 (NL735_25300) 177970..178674 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
NL735_RS25305 (NL735_25305) 178776..179630 - 855 Protein_188 Tn3 family transposase -
NL735_RS25310 (NL735_25310) 179826..180218 + 393 WP_000084745.1 pyridoxamine 5'-phosphate oxidase family protein -
NL735_RS25315 (NL735_25315) 180329..181033 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
NL735_RS25325 (NL735_25325) 182850..183101 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NL735_RS25330 (NL735_25330) 183091..183372 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NL735_RS25335 (NL735_25335) 183611..183703 - 93 Protein_194 IS6 family transposase -
NL735_RS25340 (NL735_25340) 183869..185068 - 1200 WP_000948429.1 IS91 family transposase -
NL735_RS25345 (NL735_25345) 185078..185266 - 189 WP_000957857.1 hypothetical protein -
NL735_RS25350 (NL735_25350) 185386..186816 + 1431 Protein_197 IS4-like element IS50R family transposase -
NL735_RS25355 (NL735_25355) 186845..187639 + 795 WP_000572405.1 aminoglycoside O-phosphotransferase APH(3')-IIa -
NL735_RS25360 (NL735_25360) 187660..187869 + 210 Protein_199 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-IIa / aph(6)-Ic / ant(3'')-Ia / lnu(F) / sul3 / cmlA1 / aadA2 / blaTEM-1B / tet(A) / dfrA12 / qacE / sul1 / mph(A) / aac(3)-IVa / aph(4)-Ia / floR / oqxB / oqxA - 1..278879 278879
- inside IScluster/Tn aph(3')-IIa / oqxB / oqxA - 178776..193635 14859


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T251148 WP_000220561.1 NZ_CP100708:183091-183372 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT251148 WP_000121743.1 NZ_CP100708:182850-183101 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References