Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4404738..4405519 | Replicon | chromosome |
Accession | NZ_CP100707 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0409 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NL735_RS21655 | Protein ID | WP_000626099.1 |
Coordinates | 4404738..4405229 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NL735_RS21660 | Protein ID | WP_001110452.1 |
Coordinates | 4405226..4405519 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL735_RS21615 (4399924) | 4399924..4400166 | - | 243 | WP_197603740.1 | hypothetical protein | - |
NL735_RS21620 (4400163) | 4400163..4400519 | - | 357 | WP_033567083.1 | hypothetical protein | - |
NL735_RS21625 (4400516) | 4400516..4401388 | - | 873 | WP_033567082.1 | ParA family protein | - |
NL735_RS21630 (4401579) | 4401579..4401656 | - | 78 | Protein_4231 | helix-turn-helix domain-containing protein | - |
NL735_RS21635 (4401747) | 4401747..4402079 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NL735_RS21640 (4402151) | 4402151..4402528 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NL735_RS21645 (4403561) | 4403561..4403635 | + | 75 | Protein_4234 | porin family protein | - |
NL735_RS21650 (4403738) | 4403738..4404490 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NL735_RS21655 (4404738) | 4404738..4405229 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NL735_RS21660 (4405226) | 4405226..4405519 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NL735_RS21665 (4405836) | 4405836..4406057 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NL735_RS21670 (4406322) | 4406322..4407197 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NL735_RS21675 (4407194) | 4407194..4407481 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NL735_RS21680 (4407504) | 4407504..4407719 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NL735_RS21685 (4407727) | 4407727..4407996 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NL735_RS21690 (4408290) | 4408290..4409195 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T251144 WP_000626099.1 NZ_CP100707:c4405229-4404738 [Salmonella enterica subsp. enterica serovar Typhimurium]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT251144 WP_001110452.1 NZ_CP100707:c4405519-4405226 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|