Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3481485..3482105 | Replicon | chromosome |
Accession | NZ_CP100707 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R18.0409 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL735_RS17275 | Protein ID | WP_001280991.1 |
Coordinates | 3481887..3482105 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL735_RS17270 | Protein ID | WP_000344807.1 |
Coordinates | 3481485..3481859 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL735_RS17260 (3476624) | 3476624..3477817 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL735_RS17265 (3477840) | 3477840..3480989 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL735_RS17270 (3481485) | 3481485..3481859 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL735_RS17275 (3481887) | 3481887..3482105 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL735_RS17280 (3482284) | 3482284..3482835 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NL735_RS17285 (3482952) | 3482952..3483422 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NL735_RS17290 (3483478) | 3483478..3483618 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL735_RS17295 (3483624) | 3483624..3483884 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NL735_RS17300 (3484109) | 3484109..3485659 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NL735_RS17310 (3485890) | 3485890..3486279 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NL735_RS17315 (3486312) | 3486312..3486881 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251139 WP_001280991.1 NZ_CP100707:3481887-3482105 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251139 WP_000344807.1 NZ_CP100707:3481485-3481859 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|