Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelE-RHH |
Location | 1949..2496 | Replicon | plasmid pR18.0872_93k |
Accession | NZ_CP100704 | ||
Organism | Salmonella enterica subsp. enterica serovar Thompson strain R18.0872 |
Toxin (Protein)
Gene name | parE | Uniprot ID | G7QEJ9 |
Locus tag | NL734_RS24160 | Protein ID | WP_001384452.1 |
Coordinates | 2218..2496 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | W0FTF6 |
Locus tag | NL734_RS24155 | Protein ID | WP_000079942.1 |
Coordinates | 1949..2218 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL734_RS24150 (1) | 1..1032 | + | 1032 | WP_022630251.1 | plasmid replication initiator RepA | - |
NL734_RS24155 (1949) | 1949..2218 | + | 270 | WP_000079942.1 | type II toxin-antitoxin system antitoxin YacA | Antitoxin |
NL734_RS24160 (2218) | 2218..2496 | + | 279 | WP_001384452.1 | type II toxin-antitoxin system toxin YacB | Toxin |
NL734_RS24165 (2542) | 2542..2754 | + | 213 | Protein_3 | 3'-5' exonuclease | - |
NL734_RS24170 (3013) | 3013..3942 | - | 930 | WP_000102288.1 | hypothetical protein | - |
NL734_RS24175 (4379) | 4379..5566 | - | 1188 | WP_001697863.1 | IS91 family transposase | - |
NL734_RS24180 (5566) | 5566..5931 | - | 366 | WP_000124134.1 | hypothetical protein | - |
NL734_RS24185 (6079) | 6079..7371 | - | 1293 | Protein_7 | ISL3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCMY-2 | - | 1..93173 | 93173 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10762.38 Da Isoelectric Point: 8.4615
>T251123 WP_001384452.1 NZ_CP100704:2218-2496 [Salmonella enterica subsp. enterica serovar Thompson]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CL36 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A140JYS5 |