Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4122962..4123478 | Replicon | chromosome |
| Accession | NZ_CP100702 | ||
| Organism | Salmonella enterica subsp. enterica serovar Thompson strain R18.0872 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | NL734_RS20240 | Protein ID | WP_000220578.1 |
| Coordinates | 4122962..4123246 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | NL734_RS20245 | Protein ID | WP_000212724.1 |
| Coordinates | 4123236..4123478 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL734_RS20225 (4118078) | 4118078..4119730 | + | 1653 | WP_000155049.1 | alpha,alpha-phosphotrehalase | - |
| NL734_RS20230 (4120139) | 4120139..4122277 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NL734_RS20235 (4122494) | 4122494..4122958 | + | 465 | WP_017465840.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NL734_RS20240 (4122962) | 4122962..4123246 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL734_RS20245 (4123236) | 4123236..4123478 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NL734_RS20250 (4123556) | 4123556..4125469 | - | 1914 | WP_001212135.1 | BglG family transcription antiterminator | - |
| NL734_RS20255 (4125486) | 4125486..4126226 | - | 741 | WP_023193113.1 | KDGP aldolase family protein | - |
| NL734_RS20260 (4126223) | 4126223..4127341 | - | 1119 | WP_017465839.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NL734_RS20265 (4127325) | 4127325..4128458 | - | 1134 | WP_017465838.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T251119 WP_000220578.1 NZ_CP100702:c4123246-4122962 [Salmonella enterica subsp. enterica serovar Thompson]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |