Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3413000..3413620 | Replicon | chromosome |
Accession | NZ_CP100702 | ||
Organism | Salmonella enterica subsp. enterica serovar Thompson strain R18.0872 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL734_RS16930 | Protein ID | WP_001280991.1 |
Coordinates | 3413402..3413620 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL734_RS16925 | Protein ID | WP_000344807.1 |
Coordinates | 3413000..3413374 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL734_RS16915 (3408139) | 3408139..3409332 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL734_RS16920 (3409355) | 3409355..3412504 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL734_RS16925 (3413000) | 3413000..3413374 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL734_RS16930 (3413402) | 3413402..3413620 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL734_RS16935 (3413799) | 3413799..3414350 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NL734_RS16940 (3414468) | 3414468..3414938 | + | 471 | WP_000136183.1 | YlaC family protein | - |
NL734_RS16945 (3414994) | 3414994..3415134 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL734_RS16950 (3415140) | 3415140..3415400 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NL734_RS16955 (3415625) | 3415625..3417175 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NL734_RS16965 (3417406) | 3417406..3417795 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NL734_RS16970 (3417828) | 3417828..3418397 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251116 WP_001280991.1 NZ_CP100702:3413402-3413620 [Salmonella enterica subsp. enterica serovar Thompson]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251116 WP_000344807.1 NZ_CP100702:3413000-3413374 [Salmonella enterica subsp. enterica serovar Thompson]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|