Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2317964..2318486 | Replicon | chromosome |
Accession | NZ_CP100702 | ||
Organism | Salmonella enterica subsp. enterica serovar Thompson strain R18.0872 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NL734_RS11295 | Protein ID | WP_000221343.1 |
Coordinates | 2318202..2318486 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NL734_RS11290 | Protein ID | WP_000885424.1 |
Coordinates | 2317964..2318212 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL734_RS11270 (2313685) | 2313685..2314692 | - | 1008 | WP_000201074.1 | LacI family DNA-binding transcriptional regulator | - |
NL734_RS11275 (2314950) | 2314950..2316416 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NL734_RS11280 (2316718) | 2316718..2317008 | + | 291 | WP_000742001.1 | hypothetical protein | - |
NL734_RS11285 (2317361) | 2317361..2317816 | + | 456 | Protein_2204 | helix-turn-helix domain-containing protein | - |
NL734_RS11290 (2317964) | 2317964..2318212 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL734_RS11295 (2318202) | 2318202..2318486 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL734_RS11300 (2318657) | 2318657..2319046 | + | 390 | WP_000194089.1 | RidA family protein | - |
NL734_RS11305 (2319098) | 2319098..2320177 | - | 1080 | WP_017465711.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NL734_RS11310 (2320370) | 2320370..2320858 | - | 489 | WP_017465710.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NL734_RS11315 (2320903) | 2320903..2322411 | + | 1509 | WP_017465709.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2314953..2325268 | 10315 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251115 WP_000221343.1 NZ_CP100702:2318202-2318486 [Salmonella enterica subsp. enterica serovar Thompson]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |