Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1002271..1003085 | Replicon | chromosome |
Accession | NZ_CP100702 | ||
Organism | Salmonella enterica subsp. enterica serovar Thompson strain R18.0872 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NL734_RS04785 | Protein ID | WP_000971655.1 |
Coordinates | 1002271..1002798 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NL734_RS04790 | Protein ID | WP_000855694.1 |
Coordinates | 1002795..1003085 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL734_RS04755 (998481) | 998481..998879 | + | 399 | Protein_930 | cytoplasmic protein | - |
NL734_RS04760 (999070) | 999070..999309 | + | 240 | Protein_931 | hypothetical protein | - |
NL734_RS04765 (999466) | 999466..1000134 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NL734_RS04770 (1000161) | 1000161..1000655 | + | 495 | WP_000424947.1 | hypothetical protein | - |
NL734_RS04775 (1000900) | 1000900..1001556 | - | 657 | WP_001748710.1 | protein-serine/threonine phosphatase | - |
NL734_RS04780 (1001789) | 1001789..1002198 | + | 410 | Protein_935 | IS5/IS1182 family transposase | - |
NL734_RS04785 (1002271) | 1002271..1002798 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NL734_RS04790 (1002795) | 1002795..1003085 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NL734_RS04795 (1003355) | 1003355..1003533 | - | 179 | Protein_938 | IS3 family transposase | - |
NL734_RS04800 (1003774) | 1003774..1004100 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NL734_RS04805 (1004373) | 1004373..1004720 | - | 348 | WP_023198553.1 | DUF1493 family protein | - |
NL734_RS04810 (1004705) | 1004705..1005154 | - | 450 | WP_000381612.1 | membrane protein | - |
NL734_RS04815 (1005585) | 1005585..1006028 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NL734_RS04820 (1006484) | 1006484..1007134 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1002058..1002198 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T251110 WP_000971655.1 NZ_CP100702:c1002798-1002271 [Salmonella enterica subsp. enterica serovar Thompson]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT251110 WP_000855694.1 NZ_CP100702:c1003085-1002795 [Salmonella enterica subsp. enterica serovar Thompson]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |