Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 173647..174169 Replicon plasmid pR18.2256_182k
Accession NZ_CP100699
Organism Salmonella enterica subsp. enterica serovar Agona strain R18.2256

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag NL710_RS24100 Protein ID WP_000220561.1
Coordinates 173888..174169 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NL710_RS24095 Protein ID WP_000121743.1
Coordinates 173647..173898 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL710_RS24070 (NL710_24070) 168832..169857 + 1026 WP_000742814.1 aminoglycoside O-phosphotransferase APH(4)-Ia -
NL710_RS24075 (NL710_24075) 169932..170171 + 240 Protein_178 AAC(3) family N-acetyltransferase -
NL710_RS24080 (NL710_24080) 170279..171031 - 753 WP_000602738.1 IS6 family transposase -
NL710_RS24085 (NL710_24085) 171093..171902 + 810 Protein_180 Tn3 family transposase -
NL710_RS24095 (NL710_24095) 173647..173898 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NL710_RS24100 (NL710_24100) 173888..174169 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NL710_RS24105 (NL710_24105) 174408..174500 - 93 Protein_184 IS6 family transposase -
NL710_RS24110 (NL710_24110) 174666..175865 - 1200 WP_000948429.1 IS91 family transposase -
NL710_RS24115 (NL710_24115) 175875..176063 - 189 WP_000957857.1 hypothetical protein -
NL710_RS24120 (NL710_24120) 176152..177207 - 1056 WP_254522804.1 DNA-binding protein -
NL710_RS24125 (NL710_24125) 177576..178388 + 813 WP_042634270.1 Dam family site-specific DNA-(adenine-N6)-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / aph(3')-IIa / tet(A) / dfrA12 / aadA2 / qacE / sul1 / mph(A) / aac(3)-IVa / aph(4)-Ia - 1..181948 181948


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T251105 WP_000220561.1 NZ_CP100699:173888-174169 [Salmonella enterica subsp. enterica serovar Agona]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT251105 WP_000121743.1 NZ_CP100699:173647-173898 [Salmonella enterica subsp. enterica serovar Agona]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References