Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4058080..4058630 | Replicon | chromosome |
Accession | NZ_CP100698 | ||
Organism | Salmonella enterica subsp. enterica serovar Agona strain R18.2256 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | NL710_RS19530 | Protein ID | WP_001199743.1 |
Coordinates | 4058080..4058388 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | NL710_RS19535 | Protein ID | WP_000016244.1 |
Coordinates | 4058391..4058630 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL710_RS19510 (4053125) | 4053125..4053580 | + | 456 | WP_031602458.1 | NUDIX domain-containing protein | - |
NL710_RS19515 (4053871) | 4053871..4055483 | + | 1613 | Protein_3817 | TraI domain-containing protein | - |
NL710_RS19520 (4055473) | 4055473..4056399 | + | 927 | WP_000142420.1 | site-specific integrase | - |
NL710_RS19530 (4058080) | 4058080..4058388 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
NL710_RS19535 (4058391) | 4058391..4058630 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NL710_RS19540 (4058739) | 4058739..4058987 | - | 249 | WP_000254751.1 | ribbon-helix-helix domain-containing protein | - |
NL710_RS19545 (4059178) | 4059178..4059609 | - | 432 | Protein_3823 | helix-turn-helix domain-containing protein | - |
NL710_RS19550 (4060289) | 4060289..4062922 | - | 2634 | WP_001280979.1 | phage tail tape measure protein | - |
NL710_RS19555 (4062915) | 4062915..4063034 | - | 120 | WP_001747644.1 | GpE family phage tail protein | - |
NL710_RS19560 (4063049) | 4063049..4063360 | - | 312 | WP_001292737.1 | phage tail assembly protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | fosA7 | - | 4028201..4072066 | 43865 | |
- | inside | IScluster/Tn | - | - | 4056445..4059564 | 3119 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T251100 WP_001199743.1 NZ_CP100698:c4058388-4058080 [Salmonella enterica subsp. enterica serovar Agona]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |