Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4058080..4058630 Replicon chromosome
Accession NZ_CP100698
Organism Salmonella enterica subsp. enterica serovar Agona strain R18.2256

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag NL710_RS19530 Protein ID WP_001199743.1
Coordinates 4058080..4058388 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag NL710_RS19535 Protein ID WP_000016244.1
Coordinates 4058391..4058630 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL710_RS19510 (4053125) 4053125..4053580 + 456 WP_031602458.1 NUDIX domain-containing protein -
NL710_RS19515 (4053871) 4053871..4055483 + 1613 Protein_3817 TraI domain-containing protein -
NL710_RS19520 (4055473) 4055473..4056399 + 927 WP_000142420.1 site-specific integrase -
NL710_RS19530 (4058080) 4058080..4058388 - 309 WP_001199743.1 CcdB family protein Toxin
NL710_RS19535 (4058391) 4058391..4058630 - 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NL710_RS19540 (4058739) 4058739..4058987 - 249 WP_000254751.1 ribbon-helix-helix domain-containing protein -
NL710_RS19545 (4059178) 4059178..4059609 - 432 Protein_3823 helix-turn-helix domain-containing protein -
NL710_RS19550 (4060289) 4060289..4062922 - 2634 WP_001280979.1 phage tail tape measure protein -
NL710_RS19555 (4062915) 4062915..4063034 - 120 WP_001747644.1 GpE family phage tail protein -
NL710_RS19560 (4063049) 4063049..4063360 - 312 WP_001292737.1 phage tail assembly protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage fosA7 - 4028201..4072066 43865
- inside IScluster/Tn - - 4056445..4059564 3119


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T251100 WP_001199743.1 NZ_CP100698:c4058388-4058080 [Salmonella enterica subsp. enterica serovar Agona]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT251100 WP_000016244.1 NZ_CP100698:c4058630-4058391 [Salmonella enterica subsp. enterica serovar Agona]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References