Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4749768..4750384 Replicon chromosome
Accession NZ_CP100695
Organism Salmonella enterica subsp. enterica serovar Weltevreden strain R18.0830

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag NL711_RS23035 Protein ID WP_000238494.1
Coordinates 4749768..4750142 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag NL711_RS23040 Protein ID WP_001523745.1
Coordinates 4750142..4750384 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL711_RS23020 (4747270) 4747270..4748172 + 903 WP_254519630.1 formate dehydrogenase subunit beta -
NL711_RS23025 (4748169) 4748169..4748804 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
NL711_RS23030 (4748801) 4748801..4749730 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
NL711_RS23035 (4749768) 4749768..4750142 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
NL711_RS23040 (4750142) 4750142..4750384 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
NL711_RS23045 (4750589) 4750589..4751518 + 930 WP_001162862.1 alpha/beta hydrolase -
NL711_RS23050 (4751604) 4751604..4751915 + 312 WP_000558163.1 type II toxin-antitoxin system HigB family toxin -
NL711_RS23055 (4751912) 4751912..4752358 + 447 WP_001259011.1 type II toxin-antitoxin system HigA family antitoxin -
NL711_RS23060 (4752373) 4752373..4753314 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NL711_RS23065 (4753359) 4753359..4753796 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
NL711_RS23070 (4753793) 4753793..4754665 - 873 WP_000921423.1 virulence factor BrkB family protein -
NL711_RS23075 (4754659) 4754659..4755258 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T251082 WP_000238494.1 NZ_CP100695:c4750142-4749768 [Salmonella enterica subsp. enterica serovar Weltevreden]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT251082 WP_001523745.1 NZ_CP100695:c4750384-4750142 [Salmonella enterica subsp. enterica serovar Weltevreden]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References