Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4448645..4449426 | Replicon | chromosome |
Accession | NZ_CP100695 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R18.0830 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | NL711_RS21755 | Protein ID | WP_000626100.1 |
Coordinates | 4448645..4449136 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NL711_RS21760 | Protein ID | WP_001110452.1 |
Coordinates | 4449133..4449426 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL711_RS21725 (4444651) | 4444651..4445736 | - | 1086 | WP_000099893.1 | DNA cytosine methyltransferase | - |
NL711_RS21730 (4445906) | 4445906..4446400 | - | 495 | WP_000622310.1 | GNAT family N-acetyltransferase | - |
NL711_RS21735 (4446397) | 4446397..4446690 | - | 294 | WP_001110462.1 | DUF1778 domain-containing protein | - |
NL711_RS21740 (4447014) | 4447014..4447058 | - | 45 | WP_079827815.1 | hypothetical protein | - |
NL711_RS21745 (4447468) | 4447468..4447545 | + | 78 | Protein_4256 | porin family protein | - |
NL711_RS21750 (4447645) | 4447645..4448397 | + | 753 | WP_000842409.1 | non-specific acid phosphatase | - |
NL711_RS21755 (4448645) | 4448645..4449136 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
NL711_RS21760 (4449133) | 4449133..4449426 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NL711_RS21765 (4449743) | 4449743..4449964 | + | 222 | WP_043991167.1 | hypothetical protein | - |
NL711_RS21770 (4450225) | 4450225..4451100 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
NL711_RS21775 (4451097) | 4451097..4451384 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NL711_RS21780 (4451360) | 4451360..4451560 | - | 201 | WP_001534538.1 | ATP-binding cassette domain-containing protein | - |
NL711_RS21785 (4451580) | 4451580..4451782 | + | 203 | Protein_4264 | hypothetical protein | - |
NL711_RS21790 (4451790) | 4451790..4452057 | + | 268 | Protein_4265 | hypothetical protein | - |
NL711_RS21795 (4452352) | 4452352..4453257 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4424592..4451972 | 27380 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T251081 WP_000626100.1 NZ_CP100695:c4449136-4448645 [Salmonella enterica subsp. enterica serovar Weltevreden]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT251081 WP_001110452.1 NZ_CP100695:c4449426-4449133 [Salmonella enterica subsp. enterica serovar Weltevreden]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1DGA4 |