Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4296819..4297335 | Replicon | chromosome |
| Accession | NZ_CP100695 | ||
| Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R18.0830 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A5I6CHB9 |
| Locus tag | NL711_RS21010 | Protein ID | WP_000220581.1 |
| Coordinates | 4296819..4297103 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | NL711_RS21015 | Protein ID | WP_000212724.1 |
| Coordinates | 4297093..4297335 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL711_RS20995 (4292030) | 4292030..4293682 | + | 1653 | WP_000155038.1 | alpha,alpha-phosphotrehalase | - |
| NL711_RS21000 (4294091) | 4294091..4296229 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NL711_RS21005 (4296351) | 4296351..4296815 | + | 465 | WP_001268862.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NL711_RS21010 (4296819) | 4296819..4297103 | - | 285 | WP_000220581.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL711_RS21015 (4297093) | 4297093..4297335 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NL711_RS21020 (4297413) | 4297413..4299326 | - | 1914 | WP_001212140.1 | BglG family transcription antiterminator | - |
| NL711_RS21025 (4299343) | 4299343..4300083 | - | 741 | WP_000779255.1 | KDGP aldolase family protein | - |
| NL711_RS21030 (4300080) | 4300080..4301198 | - | 1119 | WP_001139192.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NL711_RS21035 (4301182) | 4301182..4302315 | - | 1134 | WP_000459951.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.70 Da Isoelectric Point: 10.0482
>T251079 WP_000220581.1 NZ_CP100695:c4297103-4296819 [Salmonella enterica subsp. enterica serovar Weltevreden]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I6CHB9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |