Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4243373..4243923 | Replicon | chromosome |
Accession | NZ_CP100695 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R18.0830 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | NL711_RS20725 | Protein ID | WP_001199743.1 |
Coordinates | 4243373..4243681 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | V7ITQ8 |
Locus tag | NL711_RS20730 | Protein ID | WP_000016244.1 |
Coordinates | 4243684..4243923 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL711_RS20710 (4240855) | 4240855..4240971 | + | 117 | Protein_4054 | transposase | - |
NL711_RS20715 (4241197) | 4241197..4242216 | - | 1020 | WP_001023050.1 | IS110 family transposase | - |
NL711_RS20720 (4242283) | 4242283..4243249 | + | 967 | Protein_4056 | IS3 family transposase | - |
NL711_RS20725 (4243373) | 4243373..4243681 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
NL711_RS20730 (4243684) | 4243684..4243923 | - | 240 | WP_000016244.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NL711_RS20735 (4244036) | 4244036..4244284 | - | 249 | WP_000254752.1 | ribbon-helix-helix domain-containing protein | - |
NL711_RS20740 (4244361) | 4244361..4244516 | - | 156 | Protein_4060 | DUF4942 domain-containing protein | - |
NL711_RS20745 (4244507) | 4244507..4245368 | - | 862 | Protein_4061 | IS630 family transposase | - |
NL711_RS20750 (4246146) | 4246146..4247171 | + | 1026 | WP_000369883.1 | phage portal protein | - |
NL711_RS20755 (4247199) | 4247199..4248869 | - | 1671 | WP_000368629.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4241197..4257518 | 16321 | |
- | inside | IScluster/Tn | - | - | 4240855..4245323 | 4468 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T251078 WP_001199743.1 NZ_CP100695:c4243681-4243373 [Salmonella enterica subsp. enterica serovar Weltevreden]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T4R8 |