Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4192338..4192914 | Replicon | chromosome |
Accession | NZ_CP100695 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R18.0830 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | NL711_RS20520 | Protein ID | WP_001131963.1 |
Coordinates | 4192627..4192914 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
Locus tag | NL711_RS20515 | Protein ID | WP_000063143.1 |
Coordinates | 4192338..4192640 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL711_RS20500 (4188849) | 4188849..4190999 | + | 2151 | WP_000379929.1 | pyruvate/proton symporter BtsT | - |
NL711_RS20505 (4191094) | 4191094..4191297 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
NL711_RS20510 (4191308) | 4191308..4192264 | + | 957 | WP_000187837.1 | GTPase | - |
NL711_RS20515 (4192338) | 4192338..4192640 | - | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
NL711_RS20520 (4192627) | 4192627..4192914 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
NL711_RS20525 (4193183) | 4193183..4194097 | - | 915 | WP_000290515.1 | restriction endonuclease | - |
NL711_RS20530 (4194295) | 4194295..4197804 | + | 3510 | WP_001043490.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T251077 WP_001131963.1 NZ_CP100695:c4192914-4192627 [Salmonella enterica subsp. enterica serovar Weltevreden]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11402.01 Da Isoelectric Point: 10.1293
>AT251077 WP_000063143.1 NZ_CP100695:c4192640-4192338 [Salmonella enterica subsp. enterica serovar Weltevreden]
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|