Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3582040..3582660 | Replicon | chromosome |
Accession | NZ_CP100695 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R18.0830 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL711_RS17685 | Protein ID | WP_001280991.1 |
Coordinates | 3582442..3582660 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL711_RS17680 | Protein ID | WP_000344807.1 |
Coordinates | 3582040..3582414 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL711_RS17670 (3577179) | 3577179..3578372 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL711_RS17675 (3578395) | 3578395..3581544 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL711_RS17680 (3582040) | 3582040..3582414 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL711_RS17685 (3582442) | 3582442..3582660 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL711_RS17690 (3582839) | 3582839..3583390 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NL711_RS17695 (3583508) | 3583508..3583978 | + | 471 | WP_000136183.1 | YlaC family protein | - |
NL711_RS17700 (3584034) | 3584034..3584174 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL711_RS17705 (3584176) | 3584176..3584439 | - | 264 | WP_000801422.1 | type B 50S ribosomal protein L31 | - |
NL711_RS17710 (3584664) | 3584664..3586214 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NL711_RS17720 (3586445) | 3586445..3586834 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NL711_RS17725 (3586867) | 3586867..3587436 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251074 WP_001280991.1 NZ_CP100695:3582442-3582660 [Salmonella enterica subsp. enterica serovar Weltevreden]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251074 WP_000344807.1 NZ_CP100695:3582040-3582414 [Salmonella enterica subsp. enterica serovar Weltevreden]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|