Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2392797..2393319 | Replicon | chromosome |
Accession | NZ_CP100695 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R18.0830 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NL711_RS11820 | Protein ID | WP_000221343.1 |
Coordinates | 2392797..2393081 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A5X3FYG4 |
Locus tag | NL711_RS11825 | Protein ID | WP_000885426.1 |
Coordinates | 2393071..2393319 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL711_RS11795 (2388357) | 2388357..2389598 | - | 1242 | WP_001095731.1 | MFS transporter | - |
NL711_RS11800 (2389588) | 2389588..2391096 | - | 1509 | WP_000199407.1 | FAD-dependent oxidoreductase | - |
NL711_RS11805 (2391141) | 2391141..2391629 | + | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NL711_RS11810 (2391822) | 2391822..2392469 | + | 648 | Protein_2312 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NL711_RS11815 (2392465) | 2392465..2392626 | - | 162 | Protein_2313 | RidA family protein | - |
NL711_RS11820 (2392797) | 2392797..2393081 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL711_RS11825 (2393071) | 2393071..2393319 | - | 249 | WP_000885426.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL711_RS11830 (2393471) | 2393471..2393590 | + | 120 | Protein_2316 | type II and III secretion system | - |
NL711_RS11835 (2393676) | 2393676..2394008 | + | 333 | WP_000253078.1 | DUF1493 family protein | - |
NL711_RS11840 (2394297) | 2394297..2394578 | - | 282 | WP_000742000.1 | hypothetical protein | - |
NL711_RS11845 (2394880) | 2394880..2396346 | - | 1467 | WP_000987828.1 | hypothetical protein | - |
NL711_RS11850 (2396604) | 2396604..2397611 | + | 1008 | WP_000201070.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251069 WP_000221343.1 NZ_CP100695:c2393081-2392797 [Salmonella enterica subsp. enterica serovar Weltevreden]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5X3FYG4 |