Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 299987..300573 Replicon chromosome
Accession NZ_CP100695
Organism Salmonella enterica subsp. enterica serovar Weltevreden strain R18.0830

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag NL711_RS01385 Protein ID WP_000174964.1
Coordinates 300205..300573 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NL711_RS01380 Protein ID WP_001520924.1
Coordinates 299987..300208 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL711_RS01355 (295007) 295007..296116 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NL711_RS01360 (296176) 296176..297102 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NL711_RS01365 (297099) 297099..298376 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
NL711_RS01370 (298373) 298373..299140 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NL711_RS01375 (299142) 299142..299855 + 714 WP_000416116.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NL711_RS01380 (299987) 299987..300208 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL711_RS01385 (300205) 300205..300573 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL711_RS01390 (300832) 300832..302148 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NL711_RS01395 (302253) 302253..303140 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NL711_RS01400 (303137) 303137..303982 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NL711_RS01405 (303985) 303985..305055 + 1071 WP_000907843.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 297099..305792 8693


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T251066 WP_000174964.1 NZ_CP100695:300205-300573 [Salmonella enterica subsp. enterica serovar Weltevreden]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT251066 WP_001520924.1 NZ_CP100695:299987-300208 [Salmonella enterica subsp. enterica serovar Weltevreden]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References