Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4225930..4226711 | Replicon | chromosome |
Accession | NZ_CP100693 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain R18.1595 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A5I1HVL4 |
Locus tag | NL712_RS20530 | Protein ID | WP_023255089.1 |
Coordinates | 4225930..4226421 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | NL712_RS20535 | Protein ID | WP_001271379.1 |
Coordinates | 4226418..4226711 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL712_RS20505 (4222811) | 4222811..4223641 | - | 831 | WP_079948288.1 | fimbria/pilus periplasmic chaperone | - |
NL712_RS20510 (4223843) | 4223843..4224055 | - | 213 | WP_001293880.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
NL712_RS20515 (4224680) | 4224680..4224823 | + | 144 | Protein_4013 | transposase | - |
NL712_RS20520 (4224840) | 4224840..4225186 | + | 347 | Protein_4014 | Rpn family recombination-promoting nuclease/putative transposase | - |
NL712_RS20525 (4225467) | 4225467..4225715 | - | 249 | Protein_4015 | IS481 family transposase | - |
NL712_RS20530 (4225930) | 4225930..4226421 | - | 492 | WP_023255089.1 | GNAT family N-acetyltransferase | Toxin |
NL712_RS20535 (4226418) | 4226418..4226711 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
NL712_RS20540 (4227029) | 4227029..4227251 | + | 223 | Protein_4018 | hypothetical protein | - |
NL712_RS20545 (4227517) | 4227517..4228392 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NL712_RS20550 (4228389) | 4228389..4228676 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NL712_RS20555 (4228699) | 4228699..4228913 | + | 215 | Protein_4021 | hypothetical protein | - |
NL712_RS20560 (4228921) | 4228921..4229064 | + | 144 | Protein_4022 | hypothetical protein | - |
NL712_RS20565 (4229176) | 4229176..4229265 | + | 90 | Protein_4023 | hypothetical protein | - |
NL712_RS20570 (4229554) | 4229554..4230459 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4215323..4229265 | 13942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17633.45 Da Isoelectric Point: 7.7297
>T251063 WP_023255089.1 NZ_CP100693:c4226421-4225930 [Salmonella enterica subsp. enterica serovar London]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT251063 WP_001271379.1 NZ_CP100693:c4226711-4226418 [Salmonella enterica subsp. enterica serovar London]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1HVL4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |