Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4111349..4111865 | Replicon | chromosome |
| Accession | NZ_CP100693 | ||
| Organism | Salmonella enterica subsp. enterica serovar London strain R18.1595 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A5I6CHB9 |
| Locus tag | NL712_RS19900 | Protein ID | WP_000220581.1 |
| Coordinates | 4111349..4111633 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | NL712_RS19905 | Protein ID | WP_000212724.1 |
| Coordinates | 4111623..4111865 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL712_RS19885 (4106561) | 4106561..4108213 | + | 1653 | WP_023257400.1 | alpha,alpha-phosphotrehalase | - |
| NL712_RS19890 (4108622) | 4108622..4110760 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NL712_RS19895 (4110881) | 4110881..4111345 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NL712_RS19900 (4111349) | 4111349..4111633 | - | 285 | WP_000220581.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL712_RS19905 (4111623) | 4111623..4111865 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NL712_RS19910 (4111943) | 4111943..4113856 | - | 1914 | WP_001212148.1 | BglG family transcription antiterminator | - |
| NL712_RS19915 (4113873) | 4113873..4114613 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
| NL712_RS19920 (4114610) | 4114610..4115728 | - | 1119 | WP_023256352.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NL712_RS19925 (4115712) | 4115712..4116845 | - | 1134 | WP_023257225.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10868.70 Da Isoelectric Point: 10.0482
>T251062 WP_000220581.1 NZ_CP100693:c4111633-4111349 [Salmonella enterica subsp. enterica serovar London]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I6CHB9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |