Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4026200..4026776 | Replicon | chromosome |
| Accession | NZ_CP100693 | ||
| Organism | Salmonella enterica subsp. enterica serovar London strain R18.1595 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | NL712_RS19510 | Protein ID | WP_001131963.1 |
| Coordinates | 4026489..4026776 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A5J0SGD3 |
| Locus tag | NL712_RS19505 | Protein ID | WP_023254955.1 |
| Coordinates | 4026200..4026502 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL712_RS19490 (4022710) | 4022710..4024860 | + | 2151 | WP_000379927.1 | pyruvate/proton symporter BtsT | - |
| NL712_RS19495 (4024955) | 4024955..4025158 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| NL712_RS19500 (4025169) | 4025169..4026125 | + | 957 | WP_000187838.1 | GTPase | - |
| NL712_RS19505 (4026200) | 4026200..4026502 | - | 303 | WP_023254955.1 | BrnA antitoxin family protein | Antitoxin |
| NL712_RS19510 (4026489) | 4026489..4026776 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| NL712_RS19515 (4027045) | 4027045..4027959 | - | 915 | WP_000290515.1 | restriction endonuclease | - |
| NL712_RS19520 (4028157) | 4028157..4031666 | + | 3510 | WP_023256869.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T251061 WP_001131963.1 NZ_CP100693:c4026776-4026489 [Salmonella enterica subsp. enterica serovar London]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11346.01 Da Isoelectric Point: 10.1339
>AT251061 WP_023254955.1 NZ_CP100693:c4026502-4026200 [Salmonella enterica subsp. enterica serovar London]
MSMVKHKRGNACALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSGAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNACALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSGAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|