Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3410762..3411382 | Replicon | chromosome |
Accession | NZ_CP100693 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain R18.1595 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL712_RS16665 | Protein ID | WP_001280991.1 |
Coordinates | 3411164..3411382 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL712_RS16660 | Protein ID | WP_000344807.1 |
Coordinates | 3410762..3411136 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL712_RS16650 (3405901) | 3405901..3407094 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL712_RS16655 (3407117) | 3407117..3410266 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL712_RS16660 (3410762) | 3410762..3411136 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL712_RS16665 (3411164) | 3411164..3411382 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL712_RS16670 (3411561) | 3411561..3412112 | + | 552 | WP_023243161.1 | maltose O-acetyltransferase | - |
NL712_RS16675 (3412230) | 3412230..3412700 | + | 471 | WP_000136183.1 | YlaC family protein | - |
NL712_RS16680 (3412756) | 3412756..3412896 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL712_RS16685 (3412902) | 3412902..3413162 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NL712_RS16690 (3413387) | 3413387..3414937 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NL712_RS16700 (3415168) | 3415168..3415557 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NL712_RS16705 (3415590) | 3415590..3416159 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251058 WP_001280991.1 NZ_CP100693:3411164-3411382 [Salmonella enterica subsp. enterica serovar London]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251058 WP_000344807.1 NZ_CP100693:3410762-3411136 [Salmonella enterica subsp. enterica serovar London]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|