Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 852994..853619 | Replicon | chromosome |
Accession | NZ_CP100693 | ||
Organism | Salmonella enterica subsp. enterica serovar London strain R18.1595 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NL712_RS04120 | Protein ID | WP_000911337.1 |
Coordinates | 853221..853619 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | NL712_RS04115 | Protein ID | WP_000557549.1 |
Coordinates | 852994..853221 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL712_RS04085 (848059) | 848059..849157 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
NL712_RS04090 (849167) | 849167..850684 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
NL712_RS04095 (850760) | 850760..851305 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
NL712_RS04100 (851570) | 851570..852328 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
NL712_RS04110 (852574) | 852574..852771 | - | 198 | WP_023255488.1 | hypothetical protein | - |
NL712_RS04115 (852994) | 852994..853221 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NL712_RS04120 (853221) | 853221..853619 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NL712_RS04125 (854425) | 854425..854961 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
NL712_RS04130 (855008) | 855008..855640 | + | 633 | WP_000835264.1 | YfdX family protein | - |
NL712_RS04135 (856359) | 856359..856943 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 852994..862811 | 9817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T251052 WP_000911337.1 NZ_CP100693:853221-853619 [Salmonella enterica subsp. enterica serovar London]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|