Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 843235..843895 | Replicon | chromosome |
| Accession | NZ_CP100693 | ||
| Organism | Salmonella enterica subsp. enterica serovar London strain R18.1595 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A5I0Q7R2 |
| Locus tag | NL712_RS04060 | Protein ID | WP_023255487.1 |
| Coordinates | 843482..843895 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A3U5J6N8 |
| Locus tag | NL712_RS04055 | Protein ID | WP_058805755.1 |
| Coordinates | 843235..843501 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL712_RS04035 (839164) | 839164..840597 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
| NL712_RS04040 (840755) | 840755..841066 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| NL712_RS04045 (841230) | 841230..841889 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| NL712_RS04050 (842005) | 842005..842985 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
| NL712_RS04055 (843235) | 843235..843501 | + | 267 | WP_058805755.1 | FAD assembly factor SdhE | Antitoxin |
| NL712_RS04060 (843482) | 843482..843895 | + | 414 | WP_023255487.1 | protein YgfX | Toxin |
| NL712_RS04065 (843948) | 843948..844469 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| NL712_RS04070 (844582) | 844582..845478 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| NL712_RS04075 (845502) | 845502..846215 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NL712_RS04080 (846221) | 846221..847954 | + | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16197.18 Da Isoelectric Point: 10.7537
>T251051 WP_023255487.1 NZ_CP100693:843482-843895 [Salmonella enterica subsp. enterica serovar London]
VILWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VILWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0Q7R2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3U5J6N8 |