Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3605510..3606130 | Replicon | chromosome |
Accession | NZ_CP100691 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain R17.3867 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NL690_RS17785 | Protein ID | WP_001280991.1 |
Coordinates | 3605912..3606130 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NL690_RS17780 | Protein ID | WP_000344807.1 |
Coordinates | 3605510..3605884 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL690_RS17770 (3600649) | 3600649..3601842 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NL690_RS17775 (3601865) | 3601865..3605014 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NL690_RS17780 (3605510) | 3605510..3605884 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NL690_RS17785 (3605912) | 3605912..3606130 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NL690_RS17790 (3606309) | 3606309..3606860 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NL690_RS17795 (3606977) | 3606977..3607447 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NL690_RS17800 (3607503) | 3607503..3607643 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NL690_RS17805 (3607649) | 3607649..3607909 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NL690_RS17810 (3608134) | 3608134..3609684 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
NL690_RS17820 (3609915) | 3609915..3610304 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NL690_RS17825 (3610337) | 3610337..3610906 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251044 WP_001280991.1 NZ_CP100691:3605912-3606130 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251044 WP_000344807.1 NZ_CP100691:3605510-3605884 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|