Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4236969..4237750 | Replicon | chromosome |
Accession | NZ_CP100689 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0287 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A0R9NZI3 |
Locus tag | FGU70_RS20560 | Protein ID | WP_000625912.1 |
Coordinates | 4236969..4237460 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | FGU70_RS20565 | Protein ID | WP_001110450.1 |
Coordinates | 4237457..4237750 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGU70_RS20535 (4233851) | 4233851..4234681 | - | 831 | WP_001180236.1 | fimbria/pilus periplasmic chaperone | - |
FGU70_RS20540 (4234925) | 4234925..4235095 | - | 171 | Protein_4014 | adhesin biosynthesis transcription regulatory family protein | - |
FGU70_RS20545 (4235719) | 4235719..4235862 | + | 144 | Protein_4015 | transposase | - |
FGU70_RS20550 (4235879) | 4235879..4236225 | + | 347 | Protein_4016 | Rpn family recombination-promoting nuclease/putative transposase | - |
FGU70_RS20555 (4236506) | 4236506..4236754 | - | 249 | Protein_4017 | IS481 family transposase | - |
FGU70_RS20560 (4236969) | 4236969..4237460 | - | 492 | WP_000625912.1 | GNAT family N-acetyltransferase | Toxin |
FGU70_RS20565 (4237457) | 4237457..4237750 | - | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
FGU70_RS20570 (4238067) | 4238067..4238289 | + | 223 | Protein_4020 | hypothetical protein | - |
FGU70_RS20575 (4238553) | 4238553..4239428 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
FGU70_RS20580 (4239425) | 4239425..4239712 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
FGU70_RS20585 (4239705) | 4239705..4239887 | - | 183 | WP_001670702.1 | ATP-binding cassette domain-containing protein | - |
FGU70_RS20590 (4239907) | 4239907..4240006 | + | 100 | Protein_4024 | hypothetical protein | - |
FGU70_RS20595 (4240123) | 4240123..4240257 | + | 135 | Protein_4025 | hypothetical protein | - |
FGU70_RS20600 (4240552) | 4240552..4241457 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4230057..4239712 | 9655 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T251030 WP_000625912.1 NZ_CP100689:c4237460-4236969 [Salmonella enterica subsp. enterica serovar Newport]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10949.56 Da Isoelectric Point: 8.6141
>AT251030 WP_001110450.1 NZ_CP100689:c4237750-4237457 [Salmonella enterica subsp. enterica serovar Newport]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NZI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |