Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3428818..3429438 | Replicon | chromosome |
| Accession | NZ_CP100689 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0287 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | FGU70_RS16740 | Protein ID | WP_001280991.1 |
| Coordinates | 3429220..3429438 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | FGU70_RS16735 | Protein ID | WP_000344807.1 |
| Coordinates | 3428818..3429192 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGU70_RS16725 (3423957) | 3423957..3425150 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| FGU70_RS16730 (3425173) | 3425173..3428322 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| FGU70_RS16735 (3428818) | 3428818..3429192 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| FGU70_RS16740 (3429220) | 3429220..3429438 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| FGU70_RS16745 (3429617) | 3429617..3430168 | + | 552 | WP_001278794.1 | maltose O-acetyltransferase | - |
| FGU70_RS16750 (3430285) | 3430285..3430755 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| FGU70_RS16755 (3430811) | 3430811..3430951 | - | 141 | WP_001197750.1 | type B 50S ribosomal protein L36 | - |
| FGU70_RS16760 (3430957) | 3430957..3431217 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| FGU70_RS16765 (3431442) | 3431442..3432992 | + | 1551 | WP_000213146.1 | EAL domain-containing protein | - |
| FGU70_RS16775 (3433223) | 3433223..3433612 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| FGU70_RS16780 (3433645) | 3433645..3434214 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251026 WP_001280991.1 NZ_CP100689:3429220-3429438 [Salmonella enterica subsp. enterica serovar Newport]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251026 WP_000344807.1 NZ_CP100689:3428818-3429192 [Salmonella enterica subsp. enterica serovar Newport]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|