Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1013011..1013825 | Replicon | chromosome |
| Accession | NZ_CP100689 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0287 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | FGU70_RS04850 | Protein ID | WP_000971655.1 |
| Coordinates | 1013011..1013538 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | FGU70_RS04855 | Protein ID | WP_000855694.1 |
| Coordinates | 1013535..1013825 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGU70_RS04810 (1008132) | 1008132..1008302 | + | 171 | WP_000069461.1 | hypothetical protein | - |
| FGU70_RS04815 (1008299) | 1008299..1008916 | - | 618 | WP_000092527.1 | Fic family protein | - |
| FGU70_RS04820 (1009293) | 1009293..1009691 | + | 399 | Protein_944 | cytoplasmic protein | - |
| FGU70_RS04825 (1009882) | 1009882..1010121 | + | 240 | Protein_945 | hypothetical protein | - |
| FGU70_RS04830 (1010278) | 1010278..1010946 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| FGU70_RS04835 (1010973) | 1010973..1011467 | + | 495 | WP_000424948.1 | hypothetical protein | - |
| FGU70_RS04840 (1011639) | 1011639..1012295 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| FGU70_RS04845 (1012528) | 1012528..1012938 | + | 411 | Protein_949 | transposase | - |
| FGU70_RS04850 (1013011) | 1013011..1013538 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| FGU70_RS04855 (1013535) | 1013535..1013825 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| FGU70_RS04860 (1014095) | 1014095..1014273 | - | 179 | Protein_952 | IS3 family transposase | - |
| FGU70_RS04865 (1014514) | 1014514..1014840 | + | 327 | WP_000393302.1 | hypothetical protein | - |
| FGU70_RS04870 (1015113) | 1015113..1015460 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
| FGU70_RS04875 (1015445) | 1015445..1015894 | - | 450 | WP_000381610.1 | membrane protein | - |
| FGU70_RS04880 (1016326) | 1016326..1016769 | - | 444 | WP_000715099.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| FGU70_RS04885 (1017225) | 1017225..1017875 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | tet(B) | invH / invF / invG / invE / invA / invB | 977262..1023188 | 45926 | |
| - | flank | IS/Tn | - | - | 1012714..1012938 | 224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T251021 WP_000971655.1 NZ_CP100689:c1013538-1013011 [Salmonella enterica subsp. enterica serovar Newport]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT251021 WP_000855694.1 NZ_CP100689:c1013825-1013535 [Salmonella enterica subsp. enterica serovar Newport]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |