Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 834881..835506 | Replicon | chromosome |
Accession | NZ_CP100689 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0287 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | FGU70_RS04025 | Protein ID | WP_000911337.1 |
Coordinates | 835108..835506 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | FGU70_RS04020 | Protein ID | WP_000557545.1 |
Coordinates | 834881..835108 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGU70_RS03990 (829926) | 829926..831443 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
FGU70_RS03995 (831519) | 831519..832064 | - | 546 | WP_000133986.1 | isopentenyl-diphosphate Delta-isomerase | - |
FGU70_RS04000 (832329) | 832329..833087 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
FGU70_RS04010 (833372) | 833372..834178 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
FGU70_RS04015 (834453) | 834453..834704 | - | 252 | WP_001540858.1 | hypothetical protein | - |
FGU70_RS04020 (834881) | 834881..835108 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
FGU70_RS04025 (835108) | 835108..835506 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
FGU70_RS04030 (836313) | 836313..836849 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
FGU70_RS04035 (836896) | 836896..837528 | + | 633 | WP_000835265.1 | YfdX family protein | - |
FGU70_RS04040 (838247) | 838247..838828 | + | 582 | WP_001244652.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 834453..843300 | 8847 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T251020 WP_000911337.1 NZ_CP100689:835108-835506 [Salmonella enterica subsp. enterica serovar Newport]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|