Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 7051..7544 Replicon plasmid pR18.1297_62k
Accession NZ_CP100687
Organism Salmonella enterica subsp. enterica serovar Goldcoast strain R18.1297

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag FC640_RS23770 Protein ID WP_001230709.1
Coordinates 7051..7305 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag FC640_RS23775 Protein ID WP_000151456.1
Coordinates 7302..7544 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FC640_RS23730 (FC640_23730) 2562..2714 + 153 Protein_1 FlmC family protein -
FC640_RS23735 (FC640_23735) 2662..2781 + 120 WP_229002406.1 Hok/Gef family protein -
FC640_RS23740 (FC640_23740) 2931..3527 + 597 WP_000125165.1 ProQ/FINO family protein -
FC640_RS23745 (FC640_23745) 3545..3829 - 285 WP_001542021.1 hypothetical protein -
FC640_RS23750 (FC640_23750) 3908..4573 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
FC640_RS23755 (FC640_23755) 5163..5492 + 330 WP_001542022.1 hypothetical protein -
FC640_RS23760 (FC640_23760) 5893..6408 + 516 WP_001025393.1 J domain-containing protein -
FC640_RS23765 (FC640_23765) 6512..7054 + 543 WP_001083904.1 hypothetical protein -
FC640_RS23770 (FC640_23770) 7051..7305 + 255 WP_001230709.1 hypothetical protein Toxin
FC640_RS23775 (FC640_23775) 7302..7544 + 243 WP_000151456.1 hypothetical protein Antitoxin
FC640_RS23780 (FC640_23780) 8115..8408 + 294 WP_000673428.1 hypothetical protein -
FC640_RS23785 (FC640_23785) 8820..9263 - 444 WP_000192626.1 hypothetical protein -
FC640_RS23790 (FC640_23790) 9560..9742 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
FC640_RS23795 (FC640_23795) 9767..10204 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
FC640_RS23800 (FC640_23800) 10338..10523 - 186 Protein_15 hypothetical protein -
FC640_RS23805 (FC640_23805) 10681..11388 - 708 WP_000108794.1 hypothetical protein -
FC640_RS23810 (FC640_23810) 11390..12142 - 753 WP_000797966.1 conjugal transfer protein TraL -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..62147 62147


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T251017 WP_001230709.1 NZ_CP100687:7051-7305 [Salmonella enterica subsp. enterica serovar Goldcoast]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT251017 WP_000151456.1 NZ_CP100687:7302-7544 [Salmonella enterica subsp. enterica serovar Goldcoast]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References