Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3305171..3305791 | Replicon | chromosome |
Accession | NZ_CP100685 | ||
Organism | Salmonella enterica subsp. enterica serovar Goldcoast strain R18.1297 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | FC640_RS15950 | Protein ID | WP_001280991.1 |
Coordinates | 3305573..3305791 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | FC640_RS15945 | Protein ID | WP_000344807.1 |
Coordinates | 3305171..3305545 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FC640_RS15935 (3300310) | 3300310..3301503 | + | 1194 | WP_126524221.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
FC640_RS15940 (3301526) | 3301526..3304675 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
FC640_RS15945 (3305171) | 3305171..3305545 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
FC640_RS15950 (3305573) | 3305573..3305791 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
FC640_RS15955 (3305970) | 3305970..3306521 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
FC640_RS15960 (3306637) | 3306637..3307107 | + | 471 | WP_000136183.1 | YlaC family protein | - |
FC640_RS15965 (3307163) | 3307163..3307303 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
FC640_RS15970 (3307309) | 3307309..3307569 | - | 261 | WP_115276046.1 | type B 50S ribosomal protein L31 | - |
FC640_RS15975 (3307794) | 3307794..3309344 | + | 1551 | WP_000213138.1 | EAL domain-containing protein | - |
FC640_RS15985 (3309575) | 3309575..3309964 | + | 390 | WP_000961285.1 | MGMT family protein | - |
FC640_RS15990 (3309997) | 3309997..3310566 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T251010 WP_001280991.1 NZ_CP100685:3305573-3305791 [Salmonella enterica subsp. enterica serovar Goldcoast]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT251010 WP_000344807.1 NZ_CP100685:3305171-3305545 [Salmonella enterica subsp. enterica serovar Goldcoast]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|