Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 842443..843103 | Replicon | chromosome |
Accession | NZ_CP100685 | ||
Organism | Salmonella enterica subsp. enterica serovar Goldcoast strain R18.1297 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A3Y0E4E4 |
Locus tag | FC640_RS04060 | Protein ID | WP_000244757.1 |
Coordinates | 842690..843103 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | FC640_RS04055 | Protein ID | WP_000351186.1 |
Coordinates | 842443..842709 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FC640_RS04035 (838371) | 838371..839804 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
FC640_RS04040 (839963) | 839963..840274 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
FC640_RS04045 (840438) | 840438..841097 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
FC640_RS04050 (841213) | 841213..842193 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
FC640_RS04055 (842443) | 842443..842709 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
FC640_RS04060 (842690) | 842690..843103 | + | 414 | WP_000244757.1 | protein YgfX | Toxin |
FC640_RS04065 (843156) | 843156..843677 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
FC640_RS04070 (843790) | 843790..844686 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
FC640_RS04075 (844710) | 844710..845423 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
FC640_RS04080 (845429) | 845429..847162 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16282.29 Da Isoelectric Point: 11.1741
>T251004 WP_000244757.1 NZ_CP100685:842690-843103 [Salmonella enterica subsp. enterica serovar Goldcoast]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISRQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISRQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT251004 WP_000351186.1 NZ_CP100685:842443-842709 [Salmonella enterica subsp. enterica serovar Goldcoast]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Y0E4E4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |