Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 317360..317947 Replicon chromosome
Accession NZ_CP100685
Organism Salmonella enterica subsp. enterica serovar Goldcoast strain R18.1297

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag FC640_RS01455 Protein ID WP_133322382.1
Coordinates 317594..317947 (+) Length 118 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag FC640_RS01450 Protein ID WP_001520924.1
Coordinates 317360..317581 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FC640_RS01425 (312381) 312381..313490 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
FC640_RS01430 (313550) 313550..314476 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
FC640_RS01435 (314473) 314473..315750 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
FC640_RS01440 (315747) 315747..316514 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
FC640_RS01445 (316516) 316516..317229 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
FC640_RS01450 (317360) 317360..317581 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FC640_RS01455 (317594) 317594..317947 + 354 WP_133322382.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
FC640_RS01460 (318206) 318206..319522 + 1317 WP_133322384.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
FC640_RS01465 (319627) 319627..320514 + 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
FC640_RS01470 (320511) 320511..321356 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
FC640_RS01475 (321358) 321358..322428 + 1071 WP_001646570.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 314473..323165 8692
- inside Prophage - - 315747..323165 7418


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-109)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 118 a.a.        Molecular weight: 13015.16 Da        Isoelectric Point: 6.7252

>T251003 WP_133322382.1 NZ_CP100685:317594-317947 [Salmonella enterica subsp. enterica serovar Goldcoast]
ISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALFITLLF
LKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 354 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT251003 WP_001520924.1 NZ_CP100685:317360-317581 [Salmonella enterica subsp. enterica serovar Goldcoast]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References