Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3998142..3998658 | Replicon | chromosome |
| Accession | NZ_CP100682 | ||
| Organism | Salmonella enterica subsp. enterica serovar Goldcoast strain R18.0450 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | FC623_RS19130 | Protein ID | WP_133323120.1 |
| Coordinates | 3998142..3998426 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | FC623_RS19135 | Protein ID | WP_000212724.1 |
| Coordinates | 3998416..3998658 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FC623_RS19115 (3993354) | 3993354..3995006 | + | 1653 | WP_023137597.1 | alpha,alpha-phosphotrehalase | - |
| FC623_RS19120 (3995415) | 3995415..3997553 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| FC623_RS19125 (3997674) | 3997674..3998138 | + | 465 | WP_133323118.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| FC623_RS19130 (3998142) | 3998142..3998426 | - | 285 | WP_133323120.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FC623_RS19135 (3998416) | 3998416..3998658 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FC623_RS19140 (3998736) | 3998736..4000649 | - | 1914 | WP_001212140.1 | BglG family transcription antiterminator | - |
| FC623_RS19145 (4000666) | 4000666..4001406 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
| FC623_RS19150 (4001403) | 4001403..4002521 | - | 1119 | WP_133323122.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| FC623_RS19155 (4002505) | 4002505..4003638 | - | 1134 | WP_133323124.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10926.73 Da Isoelectric Point: 9.8739
>T250998 WP_133323120.1 NZ_CP100682:c3998426-3998142 [Salmonella enterica subsp. enterica serovar Goldcoast]
MTYELEFDPRALKEWHKLDDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLDDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|