Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3305164..3305784 | Replicon | chromosome |
| Accession | NZ_CP100682 | ||
| Organism | Salmonella enterica subsp. enterica serovar Goldcoast strain R18.0450 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | FC623_RS15955 | Protein ID | WP_001280991.1 |
| Coordinates | 3305566..3305784 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | FC623_RS15950 | Protein ID | WP_000344807.1 |
| Coordinates | 3305164..3305538 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FC623_RS15940 (3300303) | 3300303..3301496 | + | 1194 | WP_126524221.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| FC623_RS15945 (3301519) | 3301519..3304668 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| FC623_RS15950 (3305164) | 3305164..3305538 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| FC623_RS15955 (3305566) | 3305566..3305784 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| FC623_RS15960 (3305963) | 3305963..3306514 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| FC623_RS15965 (3306630) | 3306630..3307100 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| FC623_RS15970 (3307156) | 3307156..3307296 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| FC623_RS15975 (3307302) | 3307302..3307562 | - | 261 | WP_115276046.1 | type B 50S ribosomal protein L31 | - |
| FC623_RS15980 (3307787) | 3307787..3309337 | + | 1551 | WP_000213138.1 | EAL domain-containing protein | - |
| FC623_RS15990 (3309568) | 3309568..3309957 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| FC623_RS15995 (3309990) | 3309990..3310559 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T250995 WP_001280991.1 NZ_CP100682:3305566-3305784 [Salmonella enterica subsp. enterica serovar Goldcoast]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT250995 WP_000344807.1 NZ_CP100682:3305164-3305538 [Salmonella enterica subsp. enterica serovar Goldcoast]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|