Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1008050..1008864 | Replicon | chromosome |
| Accession | NZ_CP100682 | ||
| Organism | Salmonella enterica subsp. enterica serovar Goldcoast strain R18.0450 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | A0A8E5IG67 |
| Locus tag | FC623_RS04805 | Protein ID | WP_000971651.1 |
| Coordinates | 1008050..1008577 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | FC623_RS04810 | Protein ID | WP_000855694.1 |
| Coordinates | 1008574..1008864 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FC623_RS04775 (1004324) | 1004324..1004722 | + | 399 | Protein_936 | cytoplasmic protein | - |
| FC623_RS04780 (1004913) | 1004913..1005152 | + | 240 | Protein_937 | hypothetical protein | - |
| FC623_RS04785 (1005309) | 1005309..1005977 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| FC623_RS04790 (1006004) | 1006004..1006498 | + | 495 | WP_020899151.1 | hypothetical protein | - |
| FC623_RS04795 (1006670) | 1006670..1007326 | - | 657 | WP_023181885.1 | protein-serine/threonine phosphatase | - |
| FC623_RS04800 (1007559) | 1007559..1007977 | + | 419 | Protein_941 | transposase | - |
| FC623_RS04805 (1008050) | 1008050..1008577 | - | 528 | WP_000971651.1 | GNAT family N-acetyltransferase | Toxin |
| FC623_RS04810 (1008574) | 1008574..1008864 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| FC623_RS04815 (1009458) | 1009458..1009784 | + | 327 | WP_000393295.1 | hypothetical protein | - |
| FC623_RS04820 (1010057) | 1010057..1010404 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
| FC623_RS04825 (1010389) | 1010389..1010838 | - | 450 | WP_133322517.1 | hypothetical protein | - |
| FC623_RS04830 (1011270) | 1011270..1011713 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| FC623_RS04835 (1012170) | 1012170..1012820 | + | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1006670..1018133 | 11463 | |
| - | flank | IS/Tn | - | - | 1007801..1007977 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 18970.77 Da Isoelectric Point: 9.3905
>T250990 WP_000971651.1 NZ_CP100682:c1008577-1008050 [Salmonella enterica subsp. enterica serovar Goldcoast]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGGYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGGYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT250990 WP_000855694.1 NZ_CP100682:c1008864-1008574 [Salmonella enterica subsp. enterica serovar Goldcoast]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|