Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4540244..4540860 Replicon chromosome
Accession NZ_CP100678
Organism Salmonella enterica subsp. enterica serovar Anatum strain R17.0809

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NL708_RS21940 Protein ID WP_023243564.1
Coordinates 4540244..4540618 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag NL708_RS21945 Protein ID WP_001523745.1
Coordinates 4540618..4540860 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL708_RS21925 (4537746) 4537746..4538648 + 903 WP_000331364.1 formate dehydrogenase subunit beta -
NL708_RS21930 (4538645) 4538645..4539280 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
NL708_RS21935 (4539277) 4539277..4540206 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
NL708_RS21940 (4540244) 4540244..4540618 - 375 WP_023243564.1 type II toxin-antitoxin system VapC family toxin Toxin
NL708_RS21945 (4540618) 4540618..4540860 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
NL708_RS21950 (4541065) 4541065..4541994 + 930 WP_001162860.1 alpha/beta hydrolase -
NL708_RS21955 (4542080) 4542080..4542391 + 312 WP_000558166.1 type II toxin-antitoxin system HigB family toxin -
NL708_RS21960 (4542388) 4542388..4542834 + 447 WP_031609809.1 type II toxin-antitoxin system HigA family antitoxin -
NL708_RS21965 (4542849) 4542849..4543790 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NL708_RS21970 (4543835) 4543835..4544272 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
NL708_RS21975 (4544269) 4544269..4545141 - 873 WP_000921423.1 virulence factor BrkB family protein -
NL708_RS21980 (4545135) 4545135..4545734 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13880.13 Da        Isoelectric Point: 7.3567

>T250981 WP_023243564.1 NZ_CP100678:c4540618-4540244 [Salmonella enterica subsp. enterica serovar Anatum]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMAGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT250981 WP_001523745.1 NZ_CP100678:c4540860-4540618 [Salmonella enterica subsp. enterica serovar Anatum]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References