Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3408083..3408703 | Replicon | chromosome |
| Accession | NZ_CP100678 | ||
| Organism | Salmonella enterica subsp. enterica serovar Anatum strain R17.0809 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NL708_RS16675 | Protein ID | WP_001280991.1 |
| Coordinates | 3408485..3408703 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NL708_RS16670 | Protein ID | WP_000344807.1 |
| Coordinates | 3408083..3408457 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL708_RS16660 (3403222) | 3403222..3404415 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NL708_RS16665 (3404438) | 3404438..3407587 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NL708_RS16670 (3408083) | 3408083..3408457 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NL708_RS16675 (3408485) | 3408485..3408703 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NL708_RS16680 (3408882) | 3408882..3409433 | + | 552 | WP_023243161.1 | maltose O-acetyltransferase | - |
| NL708_RS16685 (3409549) | 3409549..3410019 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| NL708_RS16690 (3410075) | 3410075..3410215 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NL708_RS16695 (3410221) | 3410221..3410481 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NL708_RS16700 (3410706) | 3410706..3412256 | + | 1551 | WP_023243162.1 | EAL domain-containing protein | - |
| NL708_RS16710 (3412487) | 3412487..3412876 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| NL708_RS16715 (3412909) | 3412909..3413478 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T250977 WP_001280991.1 NZ_CP100678:3408485-3408703 [Salmonella enterica subsp. enterica serovar Anatum]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT250977 WP_000344807.1 NZ_CP100678:3408083-3408457 [Salmonella enterica subsp. enterica serovar Anatum]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|