Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2293866..2294388 | Replicon | chromosome |
Accession | NZ_CP100678 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain R17.0809 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A5U0LRG3 |
Locus tag | NL708_RS11025 | Protein ID | WP_023243932.1 |
Coordinates | 2294104..2294388 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NL708_RS11020 | Protein ID | WP_000885424.1 |
Coordinates | 2293866..2294114 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL708_RS10990 (2289979) | 2289979..2290535 | + | 557 | Protein_2148 | hypothetical protein | - |
NL708_RS10995 (2290813) | 2290813..2291094 | + | 282 | WP_001580000.1 | hypothetical protein | - |
NL708_RS11000 (2291466) | 2291466..2292062 | + | 597 | Protein_2150 | helix-turn-helix domain-containing protein | - |
NL708_RS11005 (2292118) | 2292118..2293026 | - | 909 | WP_077909464.1 | hypothetical protein | - |
NL708_RS11010 (2293177) | 2293177..2293509 | - | 333 | WP_023244369.1 | DUF1493 family protein | - |
NL708_RS11015 (2293499) | 2293499..2293714 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NL708_RS11020 (2293866) | 2293866..2294114 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NL708_RS11025 (2294104) | 2294104..2294388 | + | 285 | WP_023243932.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NL708_RS11030 (2294559) | 2294559..2294944 | + | 386 | Protein_2156 | RidA family protein | - |
NL708_RS11035 (2294996) | 2294996..2296075 | - | 1080 | WP_023244370.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NL708_RS11040 (2296268) | 2296268..2296756 | - | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NL708_RS11045 (2296801) | 2296801..2298309 | + | 1509 | WP_110962170.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2290813..2301166 | 10353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11057.82 Da Isoelectric Point: 10.6500
>T250975 WP_023243932.1 NZ_CP100678:2294104-2294388 [Salmonella enterica subsp. enterica serovar Anatum]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAIYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAIYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5U0LRG3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |