Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1829529..1830119 | Replicon | chromosome |
| Accession | NZ_CP100678 | ||
| Organism | Salmonella enterica subsp. enterica serovar Anatum strain R17.0809 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A5Z3IR43 |
| Locus tag | NL708_RS08645 | Protein ID | WP_023243734.1 |
| Coordinates | 1829787..1830119 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A618JW87 |
| Locus tag | NL708_RS08640 | Protein ID | WP_023243733.1 |
| Coordinates | 1829529..1829786 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL708_RS08625 (1826191) | 1826191..1828146 | - | 1956 | WP_024149369.1 | hypothetical protein | - |
| NL708_RS08630 (1828505) | 1828505..1828978 | + | 474 | WP_023244266.1 | hypothetical protein | - |
| NL708_RS08635 (1828975) | 1828975..1829181 | + | 207 | WP_023243732.1 | helix-turn-helix transcriptional regulator | - |
| NL708_RS08640 (1829529) | 1829529..1829786 | + | 258 | WP_023243733.1 | MazE family transcriptional regulator | Antitoxin |
| NL708_RS08645 (1829787) | 1829787..1830119 | + | 333 | WP_023243734.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NL708_RS08650 (1830954) | 1830954..1831838 | + | 885 | WP_031609821.1 | integrase domain-containing protein | - |
| NL708_RS08655 (1832783) | 1832783..1834045 | - | 1263 | WP_023244267.1 | integrase arm-type DNA-binding domain-containing protein | - |
| NL708_RS08665 (1834704) | 1834704..1835009 | - | 306 | Protein_1692 | Arm DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11779.65 Da Isoelectric Point: 10.5834
>T250970 WP_023243734.1 NZ_CP100678:1829787-1830119 [Salmonella enterica subsp. enterica serovar Anatum]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVIPVTSGGNFARAAGFTVSLEGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVIPVTSGGNFARAAGFTVSLEGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3IR43 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A618JW87 |