Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 832364..832989 | Replicon | chromosome |
Accession | NZ_CP100678 | ||
Organism | Salmonella enterica subsp. enterica serovar Anatum strain R17.0809 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NL708_RS04035 | Protein ID | WP_000911337.1 |
Coordinates | 832591..832989 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | NL708_RS04030 | Protein ID | WP_000557549.1 |
Coordinates | 832364..832591 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL708_RS04000 (827428) | 827428..828526 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
NL708_RS04005 (828536) | 828536..830053 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
NL708_RS04010 (830129) | 830129..830674 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
NL708_RS04015 (830939) | 830939..831697 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
NL708_RS04025 (831943) | 831943..832155 | - | 213 | WP_024149321.1 | endonuclease | - |
NL708_RS04030 (832364) | 832364..832591 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NL708_RS04035 (832591) | 832591..832989 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NL708_RS04040 (833795) | 833795..834331 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
NL708_RS04045 (834378) | 834378..835010 | + | 633 | WP_000835264.1 | YfdX family protein | - |
NL708_RS04050 (835729) | 835729..836310 | + | 582 | WP_023243212.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 831943..842167 | 10224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T250968 WP_000911337.1 NZ_CP100678:832591-832989 [Salmonella enterica subsp. enterica serovar Anatum]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|