Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 5550..6151 Replicon plasmid pR17.0904_99k
Accession NZ_CP100671
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain R17.0904

Toxin (Protein)


Gene name doc Uniprot ID U9Z1Q0
Locus tag NL713_RS23100 Protein ID WP_001216047.1
Coordinates 5771..6151 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NL713_RS23095 Protein ID WP_001190712.1
Coordinates 5550..5771 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL713_RS23070 (NL713_23070) 1335..1697 + 363 WP_001261543.1 hypothetical protein -
NL713_RS23075 (NL713_23075) 2527..3507 + 981 WP_000019440.1 IS5-like element ISKpn26 family transposase -
NL713_RS23080 (NL713_23080) 3972..4328 - 357 WP_001062545.1 hypothetical protein -
NL713_RS23085 (NL713_23085) 4329..4913 - 585 WP_042198310.1 hypothetical protein -
NL713_RS23090 (NL713_23090) 5088..5477 + 390 WP_000506730.1 S24 family peptidase -
NL713_RS23095 (NL713_23095) 5550..5771 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL713_RS23100 (NL713_23100) 5771..6151 + 381 WP_001216047.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL713_RS23105 (NL713_23105) 6156..6335 + 180 WP_000113019.1 hypothetical protein -
NL713_RS23110 (NL713_23110) 6363..7415 + 1053 WP_254520585.1 DUF968 domain-containing protein -
NL713_RS23115 (NL713_23115) 7504..7956 + 453 WP_001312282.1 late promoter-activating protein (Gp10) -
NL713_RS23120 (NL713_23120) 8043..9236 + 1194 WP_000219608.1 hypothetical protein -
NL713_RS23125 (NL713_23125) 9236..10720 + 1485 WP_000124150.1 terminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..99204 99204
- flank IS/Tn - - 2527..3507 980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13574.27 Da        Isoelectric Point: 5.1514

>T250964 WP_001216047.1 NZ_CP100671:5771-6151 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT250964 WP_001190712.1 NZ_CP100671:5550-5771 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z1Q0

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References