Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4228134..4228720 Replicon chromosome
Accession NZ_CP100670
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain R17.0904

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag NL713_RS20515 Protein ID WP_000174963.1
Coordinates 4228134..4228502 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NL713_RS20520 Protein ID WP_001520924.1
Coordinates 4228499..4228720 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL713_RS20495 (4223652) 4223652..4224722 - 1071 WP_254520461.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NL713_RS20500 (4224725) 4224725..4225570 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NL713_RS20505 (4225567) 4225567..4226454 - 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NL713_RS20510 (4226559) 4226559..4227875 - 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NL713_RS20515 (4228134) 4228134..4228502 - 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NL713_RS20520 (4228499) 4228499..4228720 - 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NL713_RS20525 (4228851) 4228851..4229565 - 715 Protein_4008 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NL713_RS20530 (4229567) 4229567..4230334 - 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NL713_RS20535 (4230331) 4230331..4231608 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
NL713_RS20540 (4231605) 4231605..4232531 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NL713_RS20545 (4232591) 4232591..4233700 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4222915..4239712 16797


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T250960 WP_000174963.1 NZ_CP100670:c4228502-4228134 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT250960 WP_001520924.1 NZ_CP100670:c4228720-4228499 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References