Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2153061..2153583 | Replicon | chromosome |
| Accession | NZ_CP100670 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain R17.0904 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | V7IL40 |
| Locus tag | NL713_RS10350 | Protein ID | WP_000221345.1 |
| Coordinates | 2153061..2153345 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | NL713_RS10355 | Protein ID | WP_000885424.1 |
| Coordinates | 2153335..2153583 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL713_RS10330 (2149136) | 2149136..2150644 | - | 1509 | WP_017441357.1 | FAD-dependent oxidoreductase | - |
| NL713_RS10335 (2150689) | 2150689..2151177 | + | 489 | WP_017441356.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| NL713_RS10340 (2151370) | 2151370..2152443 | + | 1074 | WP_017441355.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| NL713_RS10345 (2152501) | 2152501..2152890 | - | 390 | WP_001652798.1 | RidA family protein | - |
| NL713_RS10350 (2153061) | 2153061..2153345 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NL713_RS10355 (2153335) | 2153335..2153583 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NL713_RS10360 (2153996) | 2153996..2154349 | - | 354 | WP_000418733.1 | hypothetical protein | - |
| NL713_RS10365 (2154352) | 2154352..2154741 | - | 390 | WP_017441353.1 | hypothetical protein | - |
| NL713_RS10370 (2155106) | 2155106..2155222 | + | 117 | Protein_2021 | IS110 family transposase | - |
| NL713_RS10375 (2155745) | 2155745..2156077 | + | 333 | WP_017441352.1 | DUF1493 family protein | - |
| NL713_RS10380 (2156350) | 2156350..2157258 | + | 909 | WP_077906523.1 | hypothetical protein | - |
| NL713_RS10385 (2157260) | 2157260..2158040 | - | 781 | Protein_2024 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2151370..2162789 | 11419 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T250952 WP_000221345.1 NZ_CP100670:c2153345-2153061 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |