Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1152231..1152851 | Replicon | chromosome |
| Accession | NZ_CP100670 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain R17.0904 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NL713_RS05425 | Protein ID | WP_001280991.1 |
| Coordinates | 1152231..1152449 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NL713_RS05430 | Protein ID | WP_000344807.1 |
| Coordinates | 1152477..1152851 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL713_RS05385 (1147456) | 1147456..1148025 | + | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
| NL713_RS05390 (1148058) | 1148058..1148447 | - | 390 | WP_000961285.1 | MGMT family protein | - |
| NL713_RS05400 (1148678) | 1148678..1150228 | - | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| NL713_RS05405 (1150453) | 1150453..1150713 | + | 261 | WP_254520504.1 | type B 50S ribosomal protein L31 | - |
| NL713_RS05410 (1150719) | 1150719..1150859 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NL713_RS05415 (1150915) | 1150915..1151385 | - | 471 | WP_000136183.1 | YlaC family protein | - |
| NL713_RS05420 (1151501) | 1151501..1152052 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| NL713_RS05425 (1152231) | 1152231..1152449 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NL713_RS05430 (1152477) | 1152477..1152851 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NL713_RS05435 (1153347) | 1153347..1156496 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NL713_RS05440 (1156519) | 1156519..1157712 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T250951 WP_001280991.1 NZ_CP100670:c1152449-1152231 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT250951 WP_000344807.1 NZ_CP100670:c1152851-1152477 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|